SCOPe 2.06: Domain d3bjud1: 3bju D:71-221

Lineage for d3bjud1 (3bju D:71-221)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)
Family b.40.4.0: automated matches [191416] (1 protein)
not a true family
Protein automated matches [190576] (33 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225402] (8 PDB entries)
Domain d3bjud1: 3bju D:71-221 [208653]
Other proteins in same PDB: d3bjua2, d3bjub2, d3bjuc2, d3bjud2
automated match to d1bbua1
complexed with atp, ca, lys

Details for d3bjud1

PDB Entry: 3bju (more details), 2.31 Å

PDB Description: crystal structure of tetrameric form of human lysyl-trna synthetase

PDB Compounds: (D:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3bjud1:

Sequence, based on SEQRES records: (download)

>d3bjud1 b.40.4.0 (D:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
rihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
tkkgelsiipyeitllspclhmlphlhfglk

Sequence, based on observed residues (ATOM records): (download)

>d3bjud1 b.40.4.0 (D:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
rihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
tkkgelsiipyeitllspclhmlpk

SCOPe Domain Coordinates for d3bjud1:

Click to download the PDB-style file with coordinates for d3bjud1.
(The format of our PDB-style files is described here.)

Timeline for d3bjud1: