SCOPe 2.05: Domain d3bjua2: 3bju A:222-576

Lineage for d3bjua2 (3bju A:222-576)

Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheet
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)
Family d.104.1.0: automated matches [227172] (1 protein)
not a true family
Protein automated matches [226887] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225403] (8 PDB entries)
Domain d3bjua2: 3bju A:222-576 [208648]
Other proteins in same PDB: d3bjua1, d3bjub1, d3bjuc1, d3bjud1
automated match to d1bbua2
complexed with atp, ca, lys

Details for d3bjua2

PDB Entry: 3bju (more details), 2.31 Å

PDB Description: crystal structure of tetrameric form of human lysyl-trna synthetase

PDB Compounds: (A:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3bjua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjua2 d.104.1.0 (A:222-576) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkpe

SCOPe Domain Coordinates for d3bjua2:

Click to download the PDB-style file with coordinates for d3bjua2.
(The format of our PDB-style files is described here.)

Timeline for d3bjua2: