Lineage for d3bfxa1 (3bfx A:12-296)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
Pfam PF00685
similar to the nucleotide/nucleoside kinases but transfer sulphate group
Protein Sulfotransferase Sult1c2 [159556] (1 species) Species Human (Homo sapiens) [TaxId:9606] [159557] (1 PDB entry)
Uniprot O00338 12-296
Domain d3bfxa1: 3bfx A:12-296 [155239]
Other proteins in same PDB: d3bfxb_
complexed with a3p
Details for d3bfxa1
PDB Entry: 3bfx (more details), 1.8 Å
PDB Description: crystal structure of human sulfotransferase sult1c1 in complex with pap
PDB Compounds: (A:) Sulfotransferase 1C2SCOPe Domain Sequences for d3bfxa1:
Sequence, based on SEQRES records: (download)
>d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]}
klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqngdvekc
qraiiqhrhpfiewarppqpsgvekakampsprilkthlstqllppsfwennckflyvar
nakdcmvsyyhfqrmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilf
lfyedikrdpkheirkvmqfmgkkvdetvldkivqetsfekmkenpmtnrstvsksildq
sissfmrkgtvgdwknhftvaqnerfdeiyrrkmegtsinfsmel
Sequence, based on observed residues (ATOM records): (download)
>d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]}
klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqnghpfie
warppqpsgvekakampsprilkthlstqllppsfwennckflyvarnakdcmvsyyhfq
rmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilflfyedikrdpkhe
irkvmqfmgkkvdetvldkivqetsfekmkenfmrkgtvgdwknhftvaqnerfdeiyrr
kmegtsinfsmel
SCOPe Domain Coordinates for d3bfxa1:
Click to download the PDB-style file with coordinates for d3bfxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bfxa1:
- d3bfxa1 first appeared in SCOP 1.75
- d3bfxa1 appears in SCOPe 2.05
- d3bfxa1 appears in SCOPe 2.07
- d3bfxa1 appears in the current release, SCOPe 2.08
View in 3D
