Lineage for d3bcna_ (3bcn A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (24 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.1: Papain-like [54002] (26 proteins) 
Protein automated matches [190264] (12 species)
not a true protein
Species Tabernaemontana divaricata [TaxId:52861] [187993] (3 PDB entries) 
Domain d3bcna_: 3bcn A: [172538]
automated match to d1o0ea_
complexed with bme, e64
Details for d3bcna_
PDB Entry: 3bcn (more details), 2.85 Å
PDB Description: Crystal structure of a papain-like cysteine protease Ervatamin-A complexed with irreversible inhibitor E-64
PDB Compounds: (A:) Ervatamin-ASCOPe Domain Sequences for d3bcna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bcna_ d.3.1.1 (A:) automated matches {Tabernaemontana divaricata [TaxId: 52861]}
lpehvdwrakgaviplknqgkcgscwafstvttvesinqirtgnlislseqqlvdcskkn
hgckggyfdrayqyiianggidteanypykafqgpcraakkvvridgckgvpqcnenalk
navasqpsvvaidasskqfqhykggiftgpcgtklnhgvvivgygkdywivrnswgrhwg
eqgytrmkrvggcglcgiarlpfyptkax
SCOPe Domain Coordinates for d3bcna_:
Click to download the PDB-style file with coordinates for d3bcna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bcna_:
- d3bcna_ first appeared in SCOPe 2.01
- d3bcna_ appears in SCOPe 2.07
View in 3D
