Lineage for d3bc1a_ (3bc1 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the restProtein automated matches [190047] (27 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186896] (12 PDB entries) 
Domain d3bc1a_: 3bc1 A: [172533]
automated match to d2f7sa1
complexed with gnp, mg
Details for d3bc1a_
PDB Entry: 3bc1 (more details), 1.8 Å
PDB Description: crystal structure of the complex rab27a-slp2a
PDB Compounds: (A:) Ras-related protein Rab-27ASCOPe Domain Sequences for d3bc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bc1a_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdydylikflalgdsgvgktsvlyqytdgkfnskfittvgidfrekrvvyrangpdgavg
rgqrihlqlwdtaglerfrslttaffrdamgflllfdltneqsflnvrnwisqlqmhays
enpdivlcgnksdledqravkeeearelaekygipyfetsaangtnishaiemlldlimk
rmers
SCOPe Domain Coordinates for d3bc1a_:
Click to download the PDB-style file with coordinates for d3bc1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bc1a_:
- d3bc1a_ first appeared in SCOPe 2.01
- d3bc1a_ appears in SCOPe 2.04
- d3bc1a_ appears in SCOPe 2.06
- d3bc1a_ appears in the current release, SCOPe 2.08
View in 3D
