| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein automated matches [190047] (27 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186896] (12 PDB entries) |
| Domain d3bc1a_: 3bc1 A: [172533] automated match to d2f7sa1 complexed with gnp, mg |
PDB Entry: 3bc1 (more details), 1.8 Å
SCOPe Domain Sequences for d3bc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bc1a_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdydylikflalgdsgvgktsvlyqytdgkfnskfittvgidfrekrvvyrangpdgavg
rgqrihlqlwdtaglerfrslttaffrdamgflllfdltneqsflnvrnwisqlqmhays
enpdivlcgnksdledqravkeeearelaekygipyfetsaangtnishaiemlldlimk
rmers
Timeline for d3bc1a_: