Lineage for d3ba0a1 (3ba0 A:106-274)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) Protein Macrophage elastase (MMP-12) [69780] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries)
Uniprot P39900 106-263 ! Uniprot P39900 106-264
Domain d3ba0a1: 3ba0 A:106-274 [245364]
Other proteins in same PDB: d3ba0a2
automated match to d1fbla2
complexed with ca, hae, zn
Details for d3ba0a1
PDB Entry: 3ba0 (more details), 3 Å
PDB Description: crystal structure of full-length human mmp-12
PDB Compounds: (A:) Macrophage metalloelastaseSCOPe Domain Sequences for d3ba0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ba0a1 d.92.1.11 (A:106-274) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygdpkenqrlpnp
SCOPe Domain Coordinates for d3ba0a1:
Click to download the PDB-style file with coordinates for d3ba0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ba0a1:
- d3ba0a1 first appeared in SCOPe 2.04
- d3ba0a1 appears in SCOPe 2.06
- d3ba0a1 appears in the current release, SCOPe 2.08
View in 3D
