SCOPe 2.06: Domain d3b9jb2: 3b9j B:224-414

Lineage for d3b9jb2 (3b9j B:224-414)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
consists of two alpha+beta subdomains
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)
Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
automatically mapped to Pfam PF00941
Protein automated matches [232070] (1 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries)

Domain d3b9jb2: 3b9j B:224-414 [155003]
Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb1, d3b9jc1, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj1, d3b9jk1, d3b9jk2
automated match to d3b9jb2
complexed with 290, ca, fad, fes, mos, mte

Details for d3b9jb2

PDB Entry: 3b9j (more details), 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine

PDB Compounds: (B:) xanthine oxidase

SCOPe Domain Sequences for d3b9jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9jb2 d.145.1.3 (B:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3b9jb2:

Click to download the PDB-style file with coordinates for d3b9jb2.
(The format of our PDB-style files is described here.)

Timeline for d3b9jb2: