Lineage for d3b7na2 (3b7n A:95-310)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
core: 4 turns of a (beta-alpha)n superhelix
Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) 
automatically mapped to Pfam PF00650
Family c.13.1.0: automated matches [227225] (1 protein)
not a true familyProtein automated matches [226966] (3 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225409] (5 PDB entries) 
Domain d3b7na2: 3b7n A:95-310 [208550]
Other proteins in same PDB: d3b7na1
automated match to d1auaa2
complexed with act, b7n, po4
Details for d3b7na2
PDB Entry: 3b7n (more details), 1.86 Å
PDB Description: crystal structure of yeast sec14 homolog sfh1 in complex with phosphatidylinositol
PDB Compounds: (A:) Uncharacterized protein YKL091CSCOPe Domain Sequences for d3b7na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7na2 c.13.1.0 (A:95-310) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
keaedkeriklakmypqyyhhvdkdgrplyfeelgginlkkmykittekqmlrnlvkeye
lfatyrvpacsrragylietsctvldlkgislsnayhvlsyikdvadisqnyypermgkf
yiihspfgfstmfkmvkpfldpvtvskifilgssykkellkqipienlpvkyggtsvlhn
pndkfyysdigpwrdpryigpegeipnifgkftvts
SCOPe Domain Coordinates for d3b7na2:
Click to download the PDB-style file with coordinates for d3b7na2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3b7na2:
- d3b7na2 first appeared in SCOPe 2.03
- d3b7na2 appears in SCOPe 2.06
- d3b7na2 appears in the current release, SCOPe 2.08
View in 3D
