Lineage for d3b76a1 (3b76 A:408-498)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. Protein automated matches [190436] (9 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. Domain d3b76a1: 3b76 A:408-498 [231833]
    Other proteins in same PDB: d3b76a2, d3b76a3, d3b76b2, d3b76b3
    automated match to d2vrfa_
    complexed with edo, na

Details for d3b76a1

PDB Entry: 3b76 (more details), 1.7500000000000002 Å

PDB Description: crystal structure of the third pdz domain of human ligand-of-numb protein-x (lnx1) in complex with the c-terminal peptide from the coxsackievirus and adenovirus receptor
PDB Compounds: (A:) E3 ubiquitin-protein ligase LNX

SCOPe Domain Sequences for d3b76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b76a1 b.36.1.0 (A:408-498) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hekvvniqkdpgeslgmtvaggashrewdlpiyvisvepggvisrdgriktgdillnvdg
veltevsrseavallkrtsssivlkalevke

SCOPe Domain Coordinates for d3b76a1 are not available.

Timeline for d3b76a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b76a2, d3b76a3
View in 3D
Domains from other chains:
(mouse over for more information)
d3b76b1, d3b76b2, d3b76b3