Lineage for d3b6na_ (3b6n A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2202094Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2202231Family d.79.5.0: automated matches [191525] (1 protein)
    not a true family
  6. 2202232Protein automated matches [190884] (7 species)
    not a true protein
  7. 2202306Species Plasmodium vivax [TaxId:126793] [188273] (1 PDB entry)
  8. 2202307Domain d3b6na_: 3b6n A: [172442]
    automated match to d1vh8a_
    complexed with zn

Details for d3b6na_

PDB Entry: 3b6n (more details), 2.26 Å

PDB Description: crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase pv003920 from plasmodium vivax
PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3b6na_:

Sequence, based on SEQRES records: (download)

>d3b6na_ d.79.5.0 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
gvrigqgydihqirvgppedivadttadtaantadpnkqsfkrltiggvpvetisvlshs
dgdvifhalvdallggmscsdlgtlfpdgspkyknknslsflryarlllykrnyaianvd
iiviaevpkispireeivrnissalgisesqvslkgktheqlgpvgqkkaiecfanalli
rkq

Sequence, based on observed residues (ATOM records): (download)

>d3b6na_ d.79.5.0 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
gvrigqgydihqirvgppekqsfkrltiggvpvetisvlshsdgdvifhalvdallggms
csknslsflryarlllykrnyaianvdiiviaevpkispireeivrnissalgisesqvs
lkgktheqlgpvgqkkaiecfanallirkq

SCOPe Domain Coordinates for d3b6na_:

Click to download the PDB-style file with coordinates for d3b6na_.
(The format of our PDB-style files is described here.)

Timeline for d3b6na_: