Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins) lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain |
Protein automated matches [254715] (3 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [256031] (3 PDB entries) |
Domain d3b3fb_: 3b3f B: [413067] automated match to d2v7ea_ protein/RNA complex; complexed with sah |
PDB Entry: 3b3f (more details), 2.2 Å
SCOPe Domain Sequences for d3b3fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b3fb_ c.66.1.6 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} teessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsf faaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmg ymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhg vdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlh sglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtcll iankrqsydisivaqvdqtgskssnlldlknpffryt
Timeline for d3b3fb_: