Lineage for d3b26b_ (3b26 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) Protein automated matches [190229] (13 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries) 
Domain d3b26b_: 3b26 B: [193644]
automated match to d3r4pb_
complexed with b2l
Details for d3b26b_
PDB Entry: 3b26 (more details), 2.1 Å
PDB Description: Hsp90 alpha N-terminal domain in complex with an inhibitor Ro1127850
PDB Compounds: (B:) Heat shock protein HSP 90-alphaSCOPe Domain Sequences for d3b26b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b26b_ d.122.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfveke
SCOPe Domain Coordinates for d3b26b_:
Click to download the PDB-style file with coordinates for d3b26b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3b26b_:
- d3b26b_ first appeared in SCOPe 2.02
- d3b26b_ appears in SCOPe 2.07
View in 3D
