Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (121 species) not a true protein |
Species Streptococcus anginosus [TaxId:1328] [195061] (3 PDB entries) |
Domain d3b1cc_: 3b1c C: [195062] automated match to d3dzza_ complexed with gol, plp, so4 |
PDB Entry: 3b1c (more details), 1.93 Å
SCOPe Domain Sequences for d3b1cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b1cc_ c.67.1.0 (C:) automated matches {Streptococcus anginosus [TaxId: 1328]} skynfqtapnrlshhtykwketetdpqllpawiadmdfevmpevkqaihdyaeqlvygyt yasdellqavldweksehqysfdkedivfvegvvpaisiaiqaftkegeavlinspvypp farsvrlnnrklvsnslkeenglfqidfeqlendivendvklyllcnphnpggrvwerev leqighlcqkhhvilvsdeihqdltlfghehvsfntvspdfkdfalvlssatktfniagt knsyaiienptlcaqfkhqqlvnnhhevsslgyiatetayrygkpwlvalkavleeniqf aveyfaqeaprlkvmkpqgtyliwldfsdygltddalftllhdqakvilnrgsdygsege lharlniaapkslveeickrivcclpk
Timeline for d3b1cc_: