Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (2 PDB entries) |
Domain d3arcd_: 3arc D: [172311] Other proteins in same PDB: d3arcb_, d3arcc_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcz_ automated match to d2axtd1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 3arc (more details), 1.9 Å
SCOPe Domain Sequences for d3arcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arcd_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe fetfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d3arcd_: