Lineage for d3aq4a_ (3aq4 A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein ADP-ribosylation factor [52614] (16 species) 
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189615] (1 PDB entry) 
Domain d3aq4a_: 3aq4 A: [172300]
automated match to d1hura_
complexed with gdp, mg
Details for d3aq4a_
PDB Entry: 3aq4 (more details), 1.8 Å
PDB Description: Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
PDB Compounds: (A:) ADP-ribosylation factor 1SCOPe Domain Sequences for d3aq4a_:
Sequence, based on SEQRES records: (download)
>d3aq4a_ c.37.1.8 (A:) ADP-ribosylation factor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sfgklfsrlfakkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisf
tvwdvggqdkirplwrhyfqntqglifvvdsndrdrvveardelhrmlnedelrdavllv
fankqdlpnamnaaeitdklglhslrqrhwyiqstcatsgeglyegldwlsnniask
Sequence, based on observed residues (ATOM records): (download)
>d3aq4a_ c.37.1.8 (A:) ADP-ribosylation factor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sfgklfsrlfakkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisf
tvwdvglwrhyfqntqglifvvdsndrdrvveardelhrmlnedelrdavllvfankqdl
pnamnaaeitdklglhslrqrhwyiqstcatsgeglyegldwlsnniask
SCOPe Domain Coordinates for d3aq4a_:
Click to download the PDB-style file with coordinates for d3aq4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3aq4a_:
- d3aq4a_ first appeared in SCOPe 2.01
- d3aq4a_ appears in SCOPe 2.02
- d3aq4a_ appears in SCOPe 2.04
- d3aq4a_ appears in the current release, SCOPe 2.08
View in 3D
