Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins) |
Protein D-serine dehydratase [310800] (2 species) Pfam PF14031 |
Species Chicken (Gallus gallus) [TaxId:9031] [311064] (4 PDB entries) |
Domain d3anua1: 3anu A:1-18,A:263-376 [304968] Other proteins in same PDB: d3anua2 complexed with cl, plp, zn |
PDB Entry: 3anu (more details), 1.9 Å
SCOPe Domain Sequences for d3anua1:
Sequence, based on SEQRES records: (download)
>d3anua1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]} mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgagagqgpqgca aidghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyvhee gkvvalwhpvrgw
>d3anua1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]} mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgaggpqgcaaid ghpelrlvgltqehgllehqmdfgrfpvgsvlalipyhacataamhpvyyvheegkvval whpvrgw
Timeline for d3anua1: