Lineage for d3anua1 (3anu A:1-18,A:263-376)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
barrel, closed; n=6, S=8; greek-key
Many cradle-loop superfamilies may be homologous, according to PubMed 18457946Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) 
the barrel is decorated with additional structuresFamily b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins) 
Protein D-serine dehydratase [310800] (2 species)
Pfam PF14031Species Chicken (Gallus gallus) [TaxId:9031] [311064] (4 PDB entries) 
Domain d3anua1: 3anu A:1-18,A:263-376 [304968]
Other proteins in same PDB: d3anua2
complexed with cl, plp, zn
Details for d3anua1
PDB Entry: 3anu (more details), 1.9 Å
PDB Description: Crystal structure of D-serine dehydratase from chicken kidney
PDB Compounds: (A:) D-serine dehydrataseSCOPe Domain Sequences for d3anua1:
Sequence, based on SEQRES records: (download)
>d3anua1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgagagqgpqgca
aidghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyvhee
gkvvalwhpvrgw
Sequence, based on observed residues (ATOM records): (download)
>d3anua1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgaggpqgcaaid
ghpelrlvgltqehgllehqmdfgrfpvgsvlalipyhacataamhpvyyvheegkvval
whpvrgw
SCOPe Domain Coordinates for d3anua1:
Click to download the PDB-style file with coordinates for d3anua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3anua1:
View in 3D
