Lineage for d3ah6d_ (3ah6 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950720Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2950721Protein Cut A1 [89931] (5 species)
  7. 2950724Species Escherichia coli [TaxId:562] [102973] (5 PDB entries)
  8. 2950740Domain d3ah6d_: 3ah6 D: [172173]
    automated match to d1naqa_

Details for d3ah6d_

PDB Entry: 3ah6 (more details), 2.4 Å

PDB Description: Remarkable improvement of the heat stability of CutA1 from E.coli by rational protein designing
PDB Compounds: (D:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3ah6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ah6d_ d.58.5.2 (D:) Cut A1 {Escherichia coli [TaxId: 562]}
tavvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmilkt
tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnaslr

SCOPe Domain Coordinates for d3ah6d_:

Click to download the PDB-style file with coordinates for d3ah6d_.
(The format of our PDB-style files is described here.)

Timeline for d3ah6d_: