Lineage for d3adka_ (3adk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865690Protein Adenylate kinase [52554] (16 species)
  7. 2865751Species Pig (Sus scrofa) [TaxId:9823] [52555] (1 PDB entry)
  8. 2865752Domain d3adka_: 3adk A: [31885]
    complexed with so4

Details for d3adka_

PDB Entry: 3adk (more details), 2.1 Å

PDB Description: refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d3adka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}
meeklkkskiifvvggpgsgkgtqcekivqkygythlstgdllraevssgsargkmlsei
mekgqlvpletvldmlrdamvakvdtskgflidgyprevkqgeeferkigqptlllyvda
gpetmtkrllkrgetsgrvddneetikkrletyykatepviafyekrgivrkvnaegsvd
dvfsqvcthldtlk

SCOPe Domain Coordinates for d3adka_:

Click to download the PDB-style file with coordinates for d3adka_.
(The format of our PDB-style files is described here.)

Timeline for d3adka_: