Lineage for d3abza3 (3abz A:388-559)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089592Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2089593Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2089594Family b.179.1.1: PA14 [254147] (2 proteins)
    Pfam PF07691
  6. 2089595Protein Beta-glucosidase PA14 domain [254417] (1 species)
  7. 2089596Species Kluyveromyces marxianus [TaxId:4911] [254858] (2 PDB entries)
  8. 2089597Domain d3abza3: 3abz A:388-559 [245086]
    Other proteins in same PDB: d3abza1, d3abza2, d3abza4, d3abzb1, d3abzb2, d3abzb4, d3abzc1, d3abzc2, d3abzc4, d3abzd1, d3abzd2, d3abzd4
    complexed with gol

Details for d3abza3

PDB Entry: 3abz (more details), 2.15 Å

PDB Description: Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus
PDB Compounds: (A:) Beta-glucosidase I

SCOPe Domain Sequences for d3abza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abza3 b.179.1.1 (A:388-559) Beta-glucosidase PA14 domain {Kluyveromyces marxianus [TaxId: 4911]}
hksigglaesslidaakpadaensgliakfysnpveersddeepfhvtkvnrsnvhlfdf
khekvdpknpyffvtltgqyvpqedgdyifslqvygsglfylndeliidqkhnqergsfc
fgagtkertkkltlkkgqvynvrveygsgptsglvgefgaggfqagvikaid

SCOPe Domain Coordinates for d3abza3:

Click to download the PDB-style file with coordinates for d3abza3.
(The format of our PDB-style files is described here.)

Timeline for d3abza3: