Lineage for d3aaca_ (3aac A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529991Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529992Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1530087Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 1530088Protein automated matches [191181] (4 species)
    not a true protein
  7. 1530097Species Sulfolobus tokodaii [TaxId:273063] [226008] (3 PDB entries)
  8. 1530102Domain d3aaca_: 3aac A: [208182]
    automated match to d1shsa_
    mutant

Details for d3aaca_

PDB Entry: 3aac (more details), 2.4 Å

PDB Description: small heat shock protein hsp14.0 with the mutations of i120f and i122f in the form ii crystal
PDB Compounds: (A:) Putative uncharacterized protein ST1653

SCOPe Domain Sequences for d3aaca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aaca_ b.15.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
myylgkelqkrseelsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqnel
iieaereitepgvkyltqrpkyvrkvirlpynvakdaeisgkyengvltiripiagtsvf
kfe

SCOPe Domain Coordinates for d3aaca_:

Click to download the PDB-style file with coordinates for d3aaca_.
(The format of our PDB-style files is described here.)

Timeline for d3aaca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3aacb_