Lineage for d3a7ra2 (3a7r A:247-337)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.224: SufE/NifU [82648] (1 superfamily)
alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123Superfamily d.224.1: SufE/NifU [82649] (4 families) 
iron-sulfur cluster assembly proteins
Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins)
automatically mapped to Pfam PF10437Protein Two-domain LplA, C-terminal domain [160211] (1 species) Species Escherichia coli [TaxId:562] [160212] (5 PDB entries)
Uniprot P32099 247-337
Domain d3a7ra2: 3a7r A:247-337 [208149]
Other proteins in same PDB: d3a7ra1
automated match to d1x2ga1
complexed with laq, mg, so4
Details for d3a7ra2
PDB Entry: 3a7r (more details), 2.05 Å
PDB Description: Crystal structure of E. coli lipoate-protein ligase A in complex with lipoyl-AMP.
PDB Compounds: (A:) Lipoate-protein ligase ASCOPe Domain Sequences for d3a7ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a7ra2 d.224.1.3 (A:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr
SCOPe Domain Coordinates for d3a7ra2:
Click to download the PDB-style file with coordinates for d3a7ra2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3a7ra2:
- d3a7ra2 first appeared in SCOPe 2.03
- d3a7ra2 appears in SCOPe 2.06
- d3a7ra2 appears in the current release, SCOPe 2.08
View in 3D
