Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Pseudonocardia autotrophica [TaxId:2074] [189387] (8 PDB entries) |
Domain d3a4ga_: 3a4g A: [171719] automated match to d1jipa_ complexed with hem, pg0 |
PDB Entry: 3a4g (more details), 1.75 Å
SCOPe Domain Sequences for d3a4ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a4ga_ a.104.1.0 (A:) automated matches {Pseudonocardia autotrophica [TaxId: 2074]} eqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvdprlskdwr htlpedqradmpatptpmmilmdppdhtrlrklvgrsftvrrmnelepriteiadgllag lptdgpvdlmreyafqipvqvicellgvpaedrddfsawssvlvddspaddknaamgklh gylsdllerkrtepddallssllavsdedgdrlsqeelvamamllliaghettvnligng vlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgvtipagemv mlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrvaigrlfadr pelalavgldelvyrestlvrglsrmpvtmgprsa
Timeline for d3a4ga_: