Lineage for d3a3zx_ (3a3z X:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342617Domain d3a3zx_: 3a3z X: [171711]
    automated match to d1ie9a_
    complexed with 2mv, so4

Details for d3a3zx_

PDB Entry: 3a3z (more details), 1.72 Å

PDB Description: Crystal structure of the human VDR ligand binding domain bound to the synthetic agonist compound 2alpha-methyl-AMCR277A(C23S)
PDB Compounds: (X:) Vitamin D3 receptor

SCOPe Domain Sequences for d3a3zx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a3zx_ a.123.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
ecsmkltplvlevfg

SCOPe Domain Coordinates for d3a3zx_:

Click to download the PDB-style file with coordinates for d3a3zx_.
(The format of our PDB-style files is described here.)

Timeline for d3a3zx_: