Lineage for d3a2fa1 (3a2f A:1-347)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887495Species Pyrococcus furiosus [TaxId:2261] [224898] (3 PDB entries)
  8. 2887498Domain d3a2fa1: 3a2f A:1-347 [208096]
    Other proteins in same PDB: d3a2fa2, d3a2fb1, d3a2fb2
    automated match to d2vwja1
    protein/DNA complex; mutant

Details for d3a2fa1

PDB Entry: 3a2f (more details), 2.67 Å

PDB Description: crystal structure of pyrococcus furiosus dna polymerase/pcna monomer mutant complex
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d3a2fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a2fa1 c.55.3.0 (A:1-347) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
kivrivdvekvekkflgkpitvwklylehpqdvptirekvrehpavvdifeydipfakry
lidkglipmegeeelkilafdietlyhegeefgkgpiimisyadeneakvitwknidlpy
vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
sgenlervakysmedakatyelgkeflpmeiqlsrlvgqplwdvsrs

SCOPe Domain Coordinates for d3a2fa1:

Click to download the PDB-style file with coordinates for d3a2fa1.
(The format of our PDB-style files is described here.)

Timeline for d3a2fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a2fa2