Lineage for d2zyma_ (2zym A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. Protein automated matches [190039] (160 species)
    not a true protein
  7. Species Thermoactinomyces vulgaris [TaxId:2026] [193732] (5 PDB entries)
  8. Domain d2zyma_: 2zym A: [193733]
    automated match to d2ghaa_

Details for d2zyma_

PDB Entry: 2zym (more details), 1.8 Å

PDB Description: crystal structure of cyclo/maltodextrin-binding protein complexed with alpha-cyclodextrin
PDB Compounds: (A:) Solute-binding protein

SCOPe Domain Sequences for d2zyma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zyma_ c.94.1.0 (A:) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
kpdklvvwenaddgvqlnntkkwageftkktgiqvevvpvallkqqekltldgpagkgad
lvtwphdrlgeavtkgllqpiqvdnsvknqfddvamkaltyggklyglpkaiesvaliyn
kklmgqvpatydelfqyakannkpdeqkygvlfeannfyytyflfaakgaavfkeqdgtl
dpneiglnspeavqgmnevqkwftearlpqslkadtvnglfksgkvaavingpwaikdyq
aaginvgvaplpkidgkdaqtfigvkgwylsayskypkyatelmqfltskealasrfket
geippqkellndpmiknnpvvngfakqaskgvpmpsipemgvvwepinnahtfvaqgkqt
peqalndavkimkekiqtmkq

SCOPe Domain Coordinates for d2zyma_ are not available.

Timeline for d2zyma_: