| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
| Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
| Protein Magnesium transporter MgtE [160163] (2 species) |
| Species Thermus thermophilus [TaxId:274] [160164] (2 PDB entries) Uniprot Q5SMG8 132-275 |
| Domain d2zy9a2: 2zy9 A:132-275 [207999] Other proteins in same PDB: d2zy9a1, d2zy9a3, d2zy9b1, d2zy9b3 automated match to d2yvxa2 complexed with mg |
PDB Entry: 2zy9 (more details), 2.94 Å
SCOPe Domain Sequences for d2zy9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zy9a2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]}
deagglmtpeyvavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdliv
adprtrvaeimnpkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldv
leaeatedihklgavdvpdlvyse
Timeline for d2zy9a2: