Lineage for d2zxya_ (2zxy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691624Species Aquifex aeolicus [TaxId:63363] [189042] (1 PDB entry)
  8. 2691625Domain d2zxya_: 2zxy A: [171602]
    automated match to d1cora_
    complexed with hec

Details for d2zxya_

PDB Entry: 2zxy (more details), 1.15 Å

PDB Description: Crystal Structure of Cytochrome c555 from Aquifex aeolicus
PDB Compounds: (A:) cytochrome c552

SCOPe Domain Sequences for d2zxya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxya_ a.3.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
mkpqltmlkglsdaelkaladfilsh

SCOPe Domain Coordinates for d2zxya_:

Click to download the PDB-style file with coordinates for d2zxya_.
(The format of our PDB-style files is described here.)

Timeline for d2zxya_: