Lineage for d2zxxb_ (2zxx B:)

  1. Root: SCOPe 2.08
  2. Class h: Coiled coil proteins [57942] (7 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) (S)
  5. Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins)
  6. Protein Geminin coiled-coil domain [111471] (2 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry)
    Uniprot O88513 79-156
  8. Domain d2zxxb_: 2zxx B: [171597]
    Other proteins in same PDB: d2zxxc_, d2zxxf_
    protein/DNA complex

Details for d2zxxb_

PDB Entry: 2zxx (more details), 2.8 Å

PDB Description: Crystal structure of Cdt1/geminin complex
PDB Compounds: (B:) Geminin

SCOPe Domain Sequences for d2zxxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxxb_ h.1.28.1 (B:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]}
tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
aevaehvqymaevierls

SCOPe Domain Coordinates for d2zxxb_ are not available.

Timeline for d2zxxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zxxa_, d2zxxc_, d2zxxd_, d2zxxe_, d2zxxf_