Lineage for d2zu6c2 (2zu6 C:246-398)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
duplication: tandem repeat of two RecA-like (AAA) domainsProtein Initiation factor 4a [52706] (2 species)
homologous to UvrBSpecies Human (Homo sapiens) [TaxId:9606] [142305] (3 PDB entries)
Uniprot P60842 21-238
4A-I
Domain d2zu6c2: 2zu6 C:246-398 [207980]
Other proteins in same PDB: d2zu6a3, d2zu6d3
automated match to d1xtia2
protein/RNA complex; complexed with acy, edo
Details for d2zu6c2
PDB Entry: 2zu6 (more details), 2.8 Å
PDB Description: crystal structure of the eIF4A-PDCD4 complex
PDB Compounds: (C:) Eukaryotic initiation factor 4A-ISCOPe Domain Sequences for d2zu6c2:
Sequence, based on SEQRES records: (download)
>d2zu6c2 c.37.1.19 (C:246-398) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
irqfyinvereewkldtlcdlyetltitqavifintrrkvdwltekmhardftvsamhgd
mdqkerdvimrefrsgssrvlittdllargidvqqvslvinydlptnrenyihrigrggr
fgrkgvainmvteedkrtlrdietfyntsieem
Sequence, based on observed residues (ATOM records): (download)
>d2zu6c2 c.37.1.19 (C:246-398) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
irqfyinvereewkldtlcdlyetltitqavifintrrkvdwltekmhardftvsamhgd
mdqkerdvimrefrsgssrvlittdllargidvqqvslvinydlptnrenyihriggrkg
vainmvteedkrtlrdietfyntsieem
SCOPe Domain Coordinates for d2zu6c2:
Click to download the PDB-style file with coordinates for d2zu6c2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2zu6c2:
- d2zu6c2 first appeared in SCOPe 2.03
- d2zu6c2 appears in SCOPe 2.07
View in 3D
