Lineage for d2zskb1 (2zsk B:1-114)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2907332Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) (S)
  5. 2907351Family c.78.2.0: automated matches [227233] (1 protein)
    not a true family
  6. 2907352Protein automated matches [226982] (4 species)
    not a true protein
  7. 2907377Species Pyrococcus horikoshii OT3 [TaxId:70601] [225544] (1 PDB entry)
  8. 2907380Domain d2zskb1: 2zsk B:1-114 [207977]
    automated match to d1jfla1

Details for d2zskb1

PDB Entry: 2zsk (more details), 2.55 Å

PDB Description: Crystal structure of PH1733, an aspartate racemase homologue, from Pyrococcus horikoshii OT3
PDB Compounds: (B:) 226aa long hypothetical aspartate racemase

SCOPe Domain Sequences for d2zskb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zskb1 c.78.2.0 (B:1-114) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mkkigiiggttpestlyyykkyieisrekfekyfypeliiysinfkeffqnpegwegrkk
ilinaakaleragaeliafaantphlvfddvqrevnvpmvsiidavaeeilkrg

SCOPe Domain Coordinates for d2zskb1:

Click to download the PDB-style file with coordinates for d2zskb1.
(The format of our PDB-style files is described here.)

Timeline for d2zskb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zskb2