Lineage for d2zrma2 (2zrm A:271-334)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
alpha-beta(3)-alpha(2); 2 layers, alpha/betaSuperfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) 
Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein) Protein RecA protein, C-terminal domain [54754] (5 species) 
Species Mycobacterium smegmatis [TaxId:246196] [224927] (2 PDB entries) 
Domain d2zrma2: 2zrm A:271-334 [207972]
Other proteins in same PDB: d2zrma1
automated match to d1ubfa2
complexed with dtp, gol
Details for d2zrma2
PDB Entry: 2zrm (more details), 2.8 Å
PDB Description: MsRecA dATP form IV
PDB Compounds: (A:) Protein recASCOPe Domain Sequences for d2zrma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zrma2 d.48.1.1 (A:271-334) RecA protein, C-terminal domain {Mycobacterium smegmatis [TaxId: 246196]}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
igav
SCOPe Domain Coordinates for d2zrma2:
Click to download the PDB-style file with coordinates for d2zrma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2zrma2:
- d2zrma2 first appeared in SCOPe 2.03
- d2zrma2 appears in SCOPe 2.07
View in 3D
