Lineage for d2zqna_ (2zqn A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) 
Family b.42.2.1: Ricin B-like [50371] (11 proteins) 
Protein 29-kDa galactose-binding lectin [159148] (1 species)
duplication: tadem repeat of two Ricin B-like domainsSpecies Common earthworm (Lumbricus terrestris) [TaxId:6398] [159149] (3 PDB entries)
Uniprot O96048 131-260
Domain d2zqna_: 2zqn A: [154763]
automated match to d2zqna1
complexed with imd, po4
Details for d2zqna_
PDB Entry: 2zqn (more details), 1.9 Å
PDB Description: crystal structure of the earthworm r-type lectin c-half in complex with lactose
PDB Compounds: (A:) 29-kDa galactose-binding lectinSCOPe Domain Sequences for d2zqna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqna_ b.42.2.1 (A:) 29-kDa galactose-binding lectin {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
kpkffyikselngkvldiegqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndf
aidasheqietqpfdpnnpkrawivsgntiaqlsdrdivldiiksdkeagahicawkqhg
gpnqkfiiese
SCOPe Domain Coordinates for d2zqna_:
Click to download the PDB-style file with coordinates for d2zqna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2zqna_:
- d2zqna_ first appeared in SCOP 1.75, called d2zqna1
- d2zqna_ appears in SCOPe 2.04
- d2zqna_ appears in SCOPe 2.06
- d2zqna_ appears in the current release, SCOPe 2.08
View in 3D
