Class b: All beta proteins [48724] (176 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein 29-kDa galactose-binding lectin [159148] (1 species) duplication: tadem repeat of two Ricin B-like domains |
Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [159149] (3 PDB entries) Uniprot O96048 131-260 |
Domain d2zqna_: 2zqn A: [154763] automated match to d2zqna1 complexed with imd, po4 |
PDB Entry: 2zqn (more details), 1.9 Å
SCOPe Domain Sequences for d2zqna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqna_ b.42.2.1 (A:) 29-kDa galactose-binding lectin {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} kpkffyikselngkvldiegqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndf aidasheqietqpfdpnnpkrawivsgntiaqlsdrdivldiiksdkeagahicawkqhg gpnqkfiiese
Timeline for d2zqna_: