Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Transcriptional regulator Cgl2612 [140181] (1 species) |
Species Corynebacterium glutamicum [TaxId:1718] [140182] (5 PDB entries) Uniprot Q8NMG3 1-174 |
Domain d2zoya1: 2zoy A:1-74 [171391] Other proteins in same PDB: d2zoya2, d2zoyb2 complexed with gol |
PDB Entry: 2zoy (more details), 1.9 Å
SCOPe Domain Sequences for d2zoya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zoya1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella ddwdkelrditrdp
Timeline for d2zoya1: