Lineage for d2zo7a_ (2zo7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2548051Species Fungia concinna [TaxId:496660] [193728] (8 PDB entries)
  8. 2548055Domain d2zo7a_: 2zo7 A: [193729]
    automated match to d3s05b_
    mutant

Details for d2zo7a_

PDB Entry: 2zo7 (more details), 1.58 Å

PDB Description: Crystal Structure of a Kusabira-Cyan Mutant (KCY-R1), a Cyan/Green-Emitting GFP-Like Protein
PDB Compounds: (A:) Cyan/Green-emitting GFP-like protein, Kusabira-Cyan mutant (KCy-R1)

SCOPe Domain Sequences for d2zo7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zo7a_ d.22.1.0 (A:) automated matches {Fungia concinna [TaxId: 496660]}
ptmvsvikpemkmryymdgsvngheftvegegtgrpyegkqkitldvtkggplpfafdll
stvfsygnraltkypddipdyfkqcfpggyswerkfefedgglaiakaeislkgncfehk
stiegtfpdsspimqnktlgwepstekmtvrdgsmkgddasylklvgggnhkcyftttyt
akkkipnlpgshfighrissvvegtkikvmedaiahlypfng

SCOPe Domain Coordinates for d2zo7a_:

Click to download the PDB-style file with coordinates for d2zo7a_.
(The format of our PDB-style files is described here.)

Timeline for d2zo7a_: