Lineage for d2zkda1 (2zkd A:405-613)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824072Family b.122.1.12: SRA domain-like [159368] (2 proteins)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 2824073Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 2824082Species Mouse (Mus musculus) [TaxId:10090] [159371] (10 PDB entries)
    Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625
  8. 2824085Domain d2zkda1: 2zkd A:405-613 [154583]
    protein/DNA complex; complexed with act, edo

Details for d2zkda1

PDB Entry: 2zkd (more details), 1.6 Å

PDB Description: crystal structure of the sra domain of mouse np95 in complex with hemi-methylated cpg dna
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d2zkda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkda1 b.122.1.12 (A:405-613) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
gmacvgrttectivpanhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgays
lvlaggyeddvdngnyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinek
gaeaedwrqgkpvrvvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryll
rrddtepepwtregkdrtrqlgltmqype

SCOPe Domain Coordinates for d2zkda1:

Click to download the PDB-style file with coordinates for d2zkda1.
(The format of our PDB-style files is described here.)

Timeline for d2zkda1: