Lineage for d2zida2 (2zid A:464-536)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804620Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1804621Protein automated matches [226835] (30 species)
    not a true protein
  7. 1804744Species Streptococcus mutans [231716] (2 PDB entries)
  8. 1804745Domain d2zida2: 2zid A:464-536 [231719]
    Other proteins in same PDB: d2zida1
    automated match to d4aiea2
    complexed with ca

Details for d2zida2

PDB Entry: 2zid (more details), 2.2 Å

PDB Description: crystal structure of dextran glucosidase e236q complex with isomaltotriose
PDB Compounds: (A:) Dextran glucosidase

SCOPe Domain Sequences for d2zida2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zida2 b.71.1.0 (A:464-536) automated matches {Streptococcus mutans}
adfellptadkvfaylrkvreerylivvnvsdqeevleidvdkqetlisntnesaalanh
klqpwdafcikil

SCOPe Domain Coordinates for d2zida2:

Click to download the PDB-style file with coordinates for d2zida2.
(The format of our PDB-style files is described here.)

Timeline for d2zida2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zida1