Lineage for d2zida1 (2zid A:1-463)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.0: automated matches [191314] (1 protein)
not a true familyProtein automated matches [190075] (132 species)
not a true protein
Species Streptococcus mutans [231714] (2 PDB entries) 
Domain d2zida1: 2zid A:1-463 [231718]
Other proteins in same PDB: d2zida2
automated match to d4aiea1
complexed with ca
Details for d2zida1
PDB Entry: 2zid (more details), 2.2 Å
PDB Description: crystal structure of dextran glucosidase e236q complex with isomaltotriose
PDB Compounds: (A:) Dextran glucosidaseSCOPe Domain Sequences for d2zida1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zida1 c.1.8.0 (A:1-463) automated matches {Streptococcus mutans}
mqkhwwhkatvyqiypksfmdtngdgigdlkgitskldylqklgvmaiwlspvydspmdd
ngydianyeaiadifgnmadmdnlltqakmrgikiimdlvvnhtsdehawfiearehpds
serdyyiwcdqpndlesifggsawqyddksdqyylhffskkqpdlnwenanlrqkiydmm
nfwidkgiggfrmdvidmigkipaqhivsngpklhaylkemnaasfgqhdlltvgqtwga
tpeiakqysnpvnhelsmvfqfehiglqhkpeapkwdyvkelnvpalktifnkwqtelel
gqgwnslfwnnhdlprvlsiwgntgkyreksakalaillhlmrgtpyiyqgeeigmtnyp
fkdlnelddieslnyakeaftngksmetimdsirmigrdnartpmqwdasqnagfstadk
twlpvnpnykdinvqaalknsnsifytyqqliqlrkendwlvd
SCOPe Domain Coordinates for d2zida1:
Click to download the PDB-style file with coordinates for d2zida1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2zida1:
- d2zida1 first appeared in SCOPe 2.03
- d2zida1 appears in SCOPe 2.07
View in 3D
