| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
| Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
| Protein automated matches [190239] (26 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [231709] (2 PDB entries) |
| Domain d2zi8a2: 2zi8 A:133-299 [231711] automated match to d2wl3b2 complexed with fe2, sdt |
PDB Entry: 2zi8 (more details), 2.2 Å
SCOPe Domain Sequences for d2zi8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zi8a2 d.32.1.0 (A:133-299) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ghrfvtgeqgmghvvlstrddaealhfyrdvlgfrlrdsmrlppqmvgrpadgppawlrf
fgcnprhhslaflpmptssgivhlmveveqaddvglcldralrrkvpmsatlgrhvndlm
lsfymktpggfdiefgcegrqvddrdwiarestavslwghdftvgar
Timeline for d2zi8a2: