Lineage for d2zhla_ (2zhl A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534620Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1534621Protein automated matches [190437] (29 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187655] (38 PDB entries)
  8. 1534767Domain d2zhla_: 2zhl A: [171226]
    automated match to d1a3ka_

Details for d2zhla_

PDB Entry: 2zhl (more details), 1.75 Å

PDB Description: crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine dimer (crystal 2)
PDB Compounds: (A:) Galectin-9

SCOPe Domain Sequences for d2zhla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhla_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
pfhrvdtisvngsvqlsyisfq

SCOPe Domain Coordinates for d2zhla_:

Click to download the PDB-style file with coordinates for d2zhla_.
(The format of our PDB-style files is described here.)

Timeline for d2zhla_: