Lineage for d2zfzd_ (2zfz D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958075Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 2958117Family d.74.2.0: automated matches [194896] (1 protein)
    not a true family
  6. 2958118Protein automated matches [194897] (4 species)
    not a true protein
  7. 2958129Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries)
  8. 2958139Domain d2zfzd_: 2zfz D: [207853]
    automated match to d3buef_
    protein/DNA complex; complexed with arg, gai

Details for d2zfzd_

PDB Entry: 2zfz (more details), 1.85 Å

PDB Description: crystal structure of the c-terminal domain hexamer of argr from mycobacterium tuberculosis in complex with arginine
PDB Compounds: (D:) Arginine repressor

SCOPe Domain Sequences for d2zfzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfzd_ d.74.2.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ggtdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilv
varepttgaqlagmfenlr

SCOPe Domain Coordinates for d2zfzd_:

Click to download the PDB-style file with coordinates for d2zfzd_.
(The format of our PDB-style files is described here.)

Timeline for d2zfzd_: