Lineage for d2zcwa2 (2zcw A:5-116)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein Transcriptional regulator TTHA1359, N-terminal domain [141641] (1 species) Species Thermus thermophilus [TaxId:274] [141642] (2 PDB entries)
Uniprot Q5SIL0 6-117
Domain d2zcwa2: 2zcw A:5-116 [171158]
Other proteins in same PDB: d2zcwa1
complexed with mpd
Details for d2zcwa2
PDB Entry: 2zcw (more details), 1.5 Å
PDB Description: Crystal Structure of TTHA1359, a Transcriptional Regulator, CRP/FNR family from Thermus thermophilus HB8
PDB Compounds: (A:) Transcriptional regulator, FNR/CRP familySCOPe Domain Sequences for d2zcwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcwa2 b.82.3.2 (A:5-116) Transcriptional regulator TTHA1359, N-terminal domain {Thermus thermophilus [TaxId: 274]}
etvsfkagdvilypgvpgprdrayrvleglvrleavdeegnaltlrlvrpggffgeealf
gqeriyfaeaatdvrleplpenpdpellkdlaqhlsqglaeayrrierlatq
SCOPe Domain Coordinates for d2zcwa2:
Click to download the PDB-style file with coordinates for d2zcwa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2zcwa2:
- d2zcwa2 first appeared in SCOPe 2.01
- d2zcwa2 appears in SCOPe 2.07
View in 3D
