Lineage for d2zayb_ (2zay B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. Protein automated matches [190131] (85 species)
    not a true protein
  7. Species Desulfuromonas acetoxidans [TaxId:281689] [225364] (1 PDB entry)
  8. Domain d2zayb_: 2zay B: [207809]
    automated match to d3to5a_

Details for d2zayb_

PDB Entry: 2zay (more details), 2 Å

PDB Description: crystal structure of response regulator from desulfuromonas acetoxidans
PDB Compounds: (B:) Response regulator receiver protein

SCOPe Domain Sequences for d2zayb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zayb_ c.23.1.0 (B:) automated matches {Desulfuromonas acetoxidans [TaxId: 281689]}
wwrimlvdtqlpalaasisalsqegfdiiqcgnaieavpvavkthphliiteanmpkisg
mdlfnslkknpqtasipvialsgratakeeaqlldmgfidfiakpvnairlsarikrvlk
lly

SCOPe Domain Coordinates for d2zayb_ are not available.

Timeline for d2zayb_:

Domains from other chains:
(mouse over for more information)
d2zaya_