Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) similar putative active site with a conserved cysteine residue |
Family d.52.8.0: automated matches [191619] (1 protein) not a true family |
Protein automated matches [191134] (3 species) not a true protein |
Species Arabidopsis thaliana [255722] (1 PDB entry) |
Domain d2z51a1: 2z51 A:1-82 [244895] automated match to d1th5a1 complexed with mg |
PDB Entry: 2z51 (more details), 1.35 Å
SCOPe Domain Sequences for d2z51a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z51a1 d.52.8.0 (A:1-82) automated matches {Arabidopsis thaliana} mvplteenvesvldeirpylmsdggnvalheidgnvvrvklqgacgscpsstmtmkmgie rrlmekipeivavealpdeetg
Timeline for d2z51a1: