Lineage for d2z26a_ (2z26 A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.4: Dihydroorotase [63917] (2 proteins) Protein Dihydroorotase [63918] (1 species) Species Escherichia coli [TaxId:562] [63919] (14 PDB entries) 
Domain d2z26a_: 2z26 A: [170998]
automated match to d1j79a_
complexed with dor, mli, ncd, zn
Details for d2z26a_
PDB Entry: 2z26 (more details), 1.29 Å
PDB Description: thr110ala dihydroorotase from e. coli
PDB Compounds: (A:) dihydroorotaseSCOPe Domain Sequences for d2z26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z26a_ c.1.9.4 (A:) Dihydroorotase {Escherichia coli [TaxId: 562]}
psqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqri
ldavpaghdftplmtcyltdsldpnelergfnegvftaaklypanatansshgvtsvdai
mpvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkd
aadyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgf
nrvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqf
yglpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk
SCOPe Domain Coordinates for d2z26a_:
Click to download the PDB-style file with coordinates for d2z26a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2z26a_:
- d2z26a_ first appeared in SCOPe 2.01
- d2z26a_ appears in SCOPe 2.03
- d2z26a_ appears in SCOPe 2.05
- d2z26a_ appears in the current release, SCOPe 2.08
View in 3D
