![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.22: Autophagin-like [159858] (3 proteins) Pfam PF03416 |
![]() | Protein Cysteine protease ATG4B [159861] (1 species) Autophagin-1 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159862] (2 PDB entries) Uniprot Q9Y4P1 10-373! Uniprot Q9Y4P1 5-354 |
![]() | Domain d2z0da1: 2z0d A:5-354 [145769] Other proteins in same PDB: d2z0db_ |
PDB Entry: 2z0d (more details), 1.9 Å
SCOPe Domain Sequences for d2z0da1:
Sequence, based on SEQRES records: (download)
>d2z0da1 d.3.1.22 (A:5-354) Cysteine protease ATG4B {Human (Homo sapiens) [TaxId: 9606]} tltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggt gptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyys ihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcr tsvpcagatafpadsdrhcngfpagaevtnrpspwrplvlliplrlgltdineayvetlk hcfmmpqslgviggkpnsahyfigyvgeeliyldpattqpaveptdgcfipdesfhcqhp pcrmsiaeldpsiavgffckteddfndwcqqvkklsllggalpmfelveq
>d2z0da1 d.3.1.22 (A:5-354) Cysteine protease ATG4B {Human (Homo sapiens) [TaxId: 9606]} tltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggt gptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyys ihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcr tspwrplvlliplrlgltdineayvetlkhcfmmpqslgviggkpnsahyfigyvgeeli yldpattqpavepipdesfhcqhppcrmsiaeldpsiavgffckteddfndwcqqvkkla lpmfelveq
Timeline for d2z0da1: