Lineage for d2yzea1 (2yze A:11-141)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2207296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2207550Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2207765Protein automated matches [254656] (4 species)
    not a true protein
  7. 2207766Species Arthrobacter globiformis [TaxId:1665] [255720] (4 PDB entries)
  8. 2207799Domain d2yzea1: 2yze A:11-141 [153886]
    automated match to d2yzea1
    complexed with nob

Details for d2yzea1

PDB Entry: 2yze (more details), 1.99 Å

PDB Description: Crystal structure of uricase from Arthrobacter globiformis
PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d2yzea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzea1 d.96.1.4 (A:11-141) automated matches {Arthrobacter globiformis [TaxId: 1665]}
tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
evrtavleisg

SCOPe Domain Coordinates for d2yzea1:

Click to download the PDB-style file with coordinates for d2yzea1.
(The format of our PDB-style files is described here.)

Timeline for d2yzea1: