Lineage for d2yz3a1 (2yz3 A:12-236)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) 
Protein Zn metallo-beta-lactamase [56283] (11 species) 
Species Pseudomonas putida [TaxId:303] [160850] (1 PDB entry) 
Domain d2yz3a1: 2yz3 A:12-236 [153835]
automatically matched to d1ko2a_
complexed with m5p, so4, zn
Details for d2yz3a1
PDB Entry: 2yz3 (more details), 2.3 Å
PDB Description: Crystallographic Investigation of Inhibition Mode of the VIM-2 Metallo-beta-lactamase from Pseudomonas aeruginosa with Mercaptocarboxylate Inhibitor
PDB Compounds: (A:) metallo-beta-lactamaseSCOPe Domain Sequences for d2yz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yz3a1 d.157.1.1 (A:12-236) Zn metallo-beta-lactamase {Pseudomonas putida [TaxId: 303]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvv
SCOPe Domain Coordinates for d2yz3a1:
Click to download the PDB-style file with coordinates for d2yz3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2yz3a1:
- d2yz3a1 first appeared in SCOP 1.75
- d2yz3a1 appears in SCOPe 2.02
- d2yz3a1 is called d2yz3a_ in SCOPe 2.04
- d2yz3a1 appears in the current release, SCOPe 2.08, called d2yz3a_
View in 3D
