Lineage for d2yyea2 (2yye A:155-336)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. 2978195Protein Selenide, water dikinase SelD [160785] (1 species)
  7. 2978196Species Aquifex aeolicus [TaxId:63363] [160786] (4 PDB entries)
    Uniprot O67139 155-336
  8. 2978203Domain d2yyea2: 2yye A:155-336 [153832]
    Other proteins in same PDB: d2yyea1, d2yyea3, d2yyeb1, d2yyeb3
    complexed with apc, co, po4

Details for d2yyea2

PDB Entry: 2yye (more details), 2.1 Å

PDB Description: Crystal structure of selenophosphate synthetase from Aquifex aeolicus complexed with AMPCPP
PDB Compounds: (A:) Selenide, water dikinase

SCOPe Domain Sequences for d2yyea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yyea2 d.139.1.1 (A:155-336) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
itqsgaqvgqlliltkpigtgilikglkegilkeedineaienmlalndkarnlmlslda
tactdvtgfgllghawnicknsnigariffekvpyyqlsenlvkkkiypkgaienlnfvk
nylksnldnwklillsdpvtsggllftinkeklekidetakelevnywiigetiaenvle
vl

SCOPe Domain Coordinates for d2yyea2:

Click to download the PDB-style file with coordinates for d2yyea2.
(The format of our PDB-style files is described here.)

Timeline for d2yyea2: