Lineage for d2yyba_ (2yyb A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the restSuperfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) 
di-iron binding proteinFamily c.135.1.0: automated matches [191472] (1 protein)
not a true familyProtein automated matches [190747] (3 species)
not a true protein
Species Thermus thermophilus HB8 [TaxId:300852] [188432] (1 PDB entry) 
Domain d2yyba_: 2yyb A: [170929]
automated match to d1nmoa_
Details for d2yyba_
PDB Entry: 2yyb (more details), 2.6 Å
PDB Description: Crystal structure of TTHA1606 from Thermus thermophilus HB8
PDB Compounds: (A:) Hypothetical protein TTHA1606SCOPe Domain Sequences for d2yyba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yyba_ c.135.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mdrdelvryldaylriqdfpqdpslnglqvegkrtvrkvgaavdageaifrkaleeevdf
livhhglfwgkpfpivghhkrrletlfqgginlyaahlpldaheevgnnfvlarelglvd
ltpwdvgvkgrfpqptpllqvadrlgqltgmqplvhqggldhvetvilvsgsgtgllpkv
dadlfvtgepkhsvfhetferglnviyaghydtetfgvkalaahlearfglpwvfldhpt
gl
SCOPe Domain Coordinates for d2yyba_:
Click to download the PDB-style file with coordinates for d2yyba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2yyba_:
- d2yyba_ first appeared in SCOPe 2.01
- d2yyba_ appears in SCOPe 2.07
View in 3D
