Lineage for d2yvua_ (2yvu A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (158 species)
not a true protein
Species Aeropyrum pernix [TaxId:272557] [231666] (4 PDB entries) 
Domain d2yvua_: 2yvu A: [231667]
automated match to d2peza_
Details for d2yvua_
PDB Entry: 2yvu (more details), 2.1 Å
PDB Description: Crystal structure of APE1195
PDB Compounds: (A:) Probable adenylyl-sulfate kinaseSCOPe Domain Sequences for d2yvua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvua_ c.37.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
kciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsegagftreer
lrhlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvkasleevi
rrdpkglykkalkgelenftgitdpyeppenpqlvldtesntiehnvsylyslvkavie
SCOPe Domain Coordinates for d2yvua_:
Click to download the PDB-style file with coordinates for d2yvua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2yvua_:
- d2yvua_ first appeared in SCOPe 2.03
- d2yvua_ appears in SCOPe 2.07
View in 3D
